General Information

  • ID:  hor001210
  • Uniprot ID:  O46023
  • Protein name:  FLP-15
  • Gene name:  flp-15
  • Organism:  Caenorhabditis elegans
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  GGPQGPLRFG
  • Length:  10
  • Propeptide:  MQFSTLIRVAVFAVLAIATLADYDDNSVGTIPVAVDLDYFSNYVKKGGPQGPLRFGKRRGPSGPLRFGKRSSFHVAPAAEDVASWYQ
  • Signal peptide:  MQFSTLIRVAVFAVLAIATLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O46023-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001210_AF2.pdbhor001210_ESM.pdb

Physical Information

Mass: 114582 Formula: C44H68N14O12
Absent amino acids: ACDEHIKMNSTVWY Common amino acids: G
pI: 10.55 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -62 Boman Index: -880
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 5986 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17564681
  • Title:  Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry.